LC-MS/MS is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-06-27. Where a claim depends on a specific study, the study is described rather than over-claimed.
Anti-doping laboratories detect GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the most common matrix, though blood and dried blood spots may also be used in some programs. Detection depends on factors such as dose, timing, metabolism, and the sensitivity of the assay. Published methods describe limits of detection in the low nanogram per milliliter range for related compounds. Exact detection windows are not fixed for all situations and remain an area of ongoing study.
Products sold as cardarine have been found to contain incorrect compounds, variable amounts, or no active ingredient at all. Independent testing is required to verify identity and purity. Common analytical approaches include high-performance liquid chromatography, mass spectrometry, and nuclear magnetic resonance for structural confirmation. These methods can distinguish GW501516 from related PPAR agonists and from unrelated steroids. For regulators and researchers, such verification is central to interpreting both biological results and adverse event reports.
Cardarine is prohibited in competitive sport under the World Anti-Doping Agency code, where it is classified as a metabolic modulator. It is not approved as a prescription medicine in the United States, European Union, or other major markets. Regulatory action has focused on its presence in sports and in products marketed as research chemicals. Because it has no accepted medical indication, supply is often unregulated. This status creates legal and safety uncertainties for anyone who encounters the substance.
Cardarine is explicitly prohibited by the World Anti-Doping Agency under the class of PPARδ agonists. Its presence in urine or blood samples can be detected using mass spectrometry-based methods, often liquid chromatography-tandem mass spectrometry. Athletes who test positive may face sanctions, including bans from competition. The compound is also regulated as a prescription-only or unapproved drug in many countries. Enforcement varies by jurisdiction, and some regions treat it as a controlled substance. Online sales may occur despite these restrictions, creating quality and legal risks.
Laboratory detection of cardarine typically involves sample preparation followed by chromatographic separation and mass spectrometric identification. Urine is the most common matrix for anti-doping tests, though blood and hair have also been explored. Methods can target the parent compound or its metabolites, depending on the expected window of detection. Reference standards are required for accurate quantification. Matrix effects and dilution can influence results, so laboratories use internal standards and validation protocols. The exact detection window varies with dose, route, and individual metabolism.
A common misconception is that cardarine has been proven safe for human use. In reality, human clinical data are limited, and long-term animal studies have raised concerns about cancer. Another misconception is that it is a supplement or vitamin-like compound. It is a synthetic research chemical with no approved medical indication. Scientific discussion often focuses on its mechanism and detection rather than therapeutic use. Regulatory and anti-doping literature treats it primarily as a prohibited substance.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Prohibited in sport | Listed by WADA as a metabolic modulator. |
| Approved medical use | None in major jurisdictions | Not a registered drug. |
| Common test matrix | Urine | Most anti-doping samples use urine. |
| Typical detection method | LC-MS/MS | Detects parent compound and metabolites. |
| Reference standard storage | -20 °C, desiccated | Typical for analytical standards. |
Cardarine is a common name for GW501516, a synthetic compound first described in the 1990s as a selective agonist of the peroxisome proliferator-activated receptor delta. It was studied in preclinical models for metabolic and cardiovascular conditions, but it has not been approved as a medicine in the United States, Europe, or other major jurisdictions. Retail products labeled as cardarine are generally research chemicals or supplements, not pharmaceutical formulations. Because human safety and efficacy data remain limited, regulatory agencies treat it as an unapproved substance rather than a therapeutic product.
Sporting authorities added GW501516 to prohibited lists after it appeared in athlete samples and online markets. The World Anti-Doping Agency classifies it as a hormone and metabolic modulator, and its use can lead to an anti-doping rule violation. Some early laboratory work suggested effects on fatty acid oxidation and endurance-related metabolism in animals, but those findings do not establish safe or effective use in people. Reports of adverse events in humans are scarce and often anecdotal, which complicates risk assessment.
Legal status varies by country. In some places, cardarine is controlled under medicines or psychoactive substances laws; in others, it may be sold with minimal oversight as a research chemical. Customs agencies have intercepted shipments, and several national health agencies have issued warnings about products marketed for bodybuilding or performance enhancement. The lack of a standardized pharmaceutical supply means identity, purity, and contamination levels can differ widely between samples. These factors make cardarine a regulatory and public health concern rather than a conventional prescription drug.
Regulatory treatment varies, but cardarine is not approved as a medicine. Sports authorities list GW501516 as a prohibited substance, and it is banned at all times under the World Anti-Doping Agency code. Many countries restrict sales for human consumption, while online vendors market it as a research chemical. Such products may lack purity data, and their actual contents can differ from the label. Purchasing or possessing cardarine may carry legal consequences depending on jurisdiction. The compound is not a dietary supplement ingredient in regulated markets.
Clinical development stopped after rodent studies showed tumors at multiple sites. Whether those findings predict human cancer risk remains an open question, but they led sponsors to discontinue programs. Human safety data are limited to small, short-term studies that were not designed to assess cancer risk. Reported effects in those studies included changes in blood lipids, but the evidence is insufficient for medical use. Long-term consequences of nonmedical use are not well characterized. Questions about dose, duration, and individual susceptibility remain unresolved.
Cardarine is a synthetic compound also known as GW501516, GW-501516, and sometimes endurobol. It was developed as a selective agonist of peroxisome proliferator-activated receptor delta, a nuclear receptor involved in fatty acid oxidation and energy metabolism. The compound was studied in preclinical models for metabolic and cardiovascular conditions, but it did not become a marketed human medicine. In regulatory and anti-doping contexts, it is treated as a prohibited substance rather than a licensed medicine.
The pharmacological interest in cardarine centers on PPARδ activation and its downstream effects on lipid handling and mitochondrial function. In animal studies, PPARδ agonists have been associated with changes in exercise endurance and fatty acid utilization, though results vary by model and protocol. Human data remain sparse, and the absence of large controlled trials limits conclusions about efficacy. Researchers often describe the compound as a tool for probing PPARδ biology rather than a proven therapeutic agent.
Safety discussions about cardarine frequently cite rodent carcinogenicity findings reported in the 2000s. In those studies, treated animals developed tumors at multiple sites, leading sponsors to discontinue clinical development. The relevance of these findings to humans has not been resolved, but they are a major reason the compound is not approved. Current literature emphasizes uncertainty about long-term effects and the risks of unregulated use. Regulators and health agencies have not established a safe human exposure level.
During Bukele's presidency, El Salvador has hosted a number of international sporting events and one edition of the Miss Universe beauty pageant. Some experts have described El Salvador's hosting of such events as an attempt at sportswashing. Bukele has promoted surfing as part of El Salvador's tourism market. He designated part of El Salvador's Pacific coastline in the La Libertad Department as "Surf City", where the 2021 and 2023 ISA World Surfing Games were hosted. El Salvador also hosted the 2023 Central American and Caribbean Games. At the tournament's opening ceremony, Bukele rebuked critics by saying that he was "not a dictator" and told them to ask everyday Salvadorans what they thought about his "supposed dictatorship". In January 2023, Bukele announced that El Salvador would host the Miss Universe 2023 pageant; the last time El Salvador had hosted Miss Universe was in 1975. At the pageant, Bukele said that Miss Universe had given El Salvador the opportunity to "show the world what we are capable of". On the day of the pageant, 300 members of the Movement for Victims of the State of Emergency held a protest demanding the release of innocent victims of the country's gang crackdown and wanting "Miss Universe to see that Salvadorans are suffering". Some protestors wore sashes reading "Miss Political Prisoners", "Miss Persecution", and "Miss Mass Trials".
October 8 – The US begins direct negotiations with the military junta while continuing sanctions against its leader, Min Aung Hlaing, for human rights violations, notably the Rohingya genocide. The Pentagon instructs the US Central Command to get ready in case direct military operations against Iran were to resume. U.S. and Israeli officials suggests that joint strikes against Iranian nuclear, energy, and infrastructure sites might take place prior to either the November US midterm elections or the late October Israeli general election, even though Trump had not made a final decision or established a timeline. Internal assessments and energy analysts cautions that renewed hostilities would fail to lower immediate gasoline prices and could instead cause a sharp spike in global oil prices, despite the administration's goal of a military breakthrough to eventually lower domestic fuel costs. Further sanctions are put by the US on Iran's shadow fleet.
"Genius" – 3:43 "Half-Life" – 3:59 "Start Again" (Gerry Leonard) – 3:55 "On Her Mind" (Duncan Sheik, Mick Jones) – 4:11 "Such Reveries" – 5:00 "On a High" – 3:36 "Magazines" – 3:47 "For You" – 2:11 "Good Morning!" – 4:04 "Memento" – 3:47 "Shine Inside" – 10:19 Note: The American version of the album features the song "Chimera" after "Shine Inside" as part of the final track (6 minutes and 28 seconds into the track).
Sources: en.wikipedia.org
==== Supercapacitor ==== Due to graphene's high surface-area-to-mass ratio, one potential application is in the conductive plates of supercapacitors. In February 2013 researchers announced a novel technique to produce graphene supercapacitors based on the DVD burner reduction approach. In 2014 a supercapacitor was announced that was claimed to achieve energy density comparable to current lithium-ion batteries. In 2015 the technique was adapted to produce stacked, 3-D supercapacitors. Laser-induced graphene was produced on both sides of a polymer sheet. The sections were then stacked, separated by solid electrolytes, making multiple microsupercapacitors. The stacked configuration substantially increased the energy density of the result. In testing, the researchers charged and discharged the devices for thousands of cycles with almost no loss of capacitance. The resulting devices were mechanically flexible, surviving 8,000 bending cycles. This makes them potentially suitable for rolling in a cylindrical configuration. Solid-state polymeric electrolyte-based devices exhibit areal capacitance of >9 mF/cm2 at a current density of 0.02 mA/cm2, over twice that of conventional aqueous electrolytes. Also in 2015 another project announced a microsupercapacitor that is small enough to fit in wearable or implantable devices. Just one-fifth the thickness of a sheet of paper, it is capable of holding more than twice as much charge as a comparable thin-film lithium battery. The design employed laser-scribed graphene, or LSG with manganese dioxide.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Cocaine is a powerful psychostimulant and known to be one of the most widely used substances recreationally. Cocaine is a nonselective, reuptake inhibitor of the norepinephrine, serotonin, and dopamine transporters. This thwarts the absorption of these chemicals into the presynaptic terminal and allows a large concentration of dopamine, serotonin and norepinephrine to build up in the synaptic cleft. The potential for cocaine addiction is thought to be a result of its effects on dopamine transporters in the CNS, while it has been suggested that the life-threatening cardiovascular effects of cocaine may involve the inhibition of NETs at sympathetic and CNS autonomic synapses.
Sources: en.wikipedia.org
=== Sublingual administration === Estradiol tablets can be taken sublingually instead of orally. Non-micronized estradiol tablets in doses of 0.125, 0.25, and 1 mg were previously marketed for use by sublingual administration under brand names such as Diogynets, Estradiol Membrettes, and Dimenformon in the 1950s. Non-micronized estradiol has poor water solubility, but micronized estradiol is rapidly absorbed by the sublingual route. All oral estradiol tablets are micronized, as this improves the efficiency of estradiol absorption in the gastrointestinal tract. Likewise, all oral estradiol valerate tablets seem to be micronized. The sublingual route is, in actuality, probably a combination of sublingual and oral delivery of estradiol due to incidental swallowing of some of the estradiol. The absorption of sublingual estradiol can be attributed to the rich vascularization under the tongue. With administration of an oral estradiol tablet sublingually, complete dissolution of the tablet occurs within a few minutes and circulating levels of estradiol begin to rise within 5 minutes. Maximal levels of estradiol occur after 30 to 60 minutes of administration. After this, estradiol levels drop steeply within 4 hours, and this is followed by a more gradual decline in levels of estradiol and a return to baseline concentrations by 24 hours. The rapid rise and steep fall of estradiol levels with sublingual administration of estradiol is analogous to the case of intravenous injection and intranasal administration of the hormone.
11β-hydroxylation of 17OHP or P4 by CYP11B1 in the adrenal cortex into 21dF or 11OHP4, respectively, 5α-reduction by SRD5A1/SRD5A2, cleavage of a side-chain (C17-C20 bond) from the steroid nucleus by 17,20-lyase activity of CYP17A1 which converts a C21 steroid to a C19 steroid, 17β-reduction by AKR1C3 (an oxo (=O) functional group in position 17β replaced to the hydroxyl (−OH) functional group), reversible 11β-reduction/oxidation of the ketone or alcohol (an oxo (=O) functional group or hydroxyl (−OH) functional group, respectively) by HSD11B1/HSD11B2. reversible 3β-reduction/oxidation of the ketone or alcohol (an oxo (=O) functional group or hydroxyl (−OH) functional group, respectively) by AKR1C2 or AKR1C4.
In acute appendicitis, total bilirubin can rise from 20.52 μmol/L to 143 μmol/L. In pregnant women, the total bilirubin level is low in all three trimesters. The measurement of bilirubin levels in the newborns is done through the use of bilimeter or transcutanoeus bilirubinometer instead of performing LFTs. When the total serum bilirubin increases over 95th percentile for age during the first week of life for high risk babies, it is known as hyperbilirubinemia of the newborn (neonatal jaundice) and requires light therapy to reduce the amount of bilirubin in the blood. Pathological jaundice in newborns should be suspected when the serum bilirubin level rises by more than 5 mg/dL per day, serum bilirubin more than the physiological range, clinical jaundice more than 2 weeks, and conjugated bilirubin (dark urine staining clothes). Haemolytic jaundice is the commonest cause of pathological jaundice. Those babies with Rh hemolytic disease, ABO incompatibility with the mother, Glucose-6-phosphate dehydrogenase (G-6-PD) deficiency and minor blood group incompatibility are at increased risk of getting haemolytic jaundice.
== Opioid replacement therapy == According to a Cochrane review in 2013, extended-release morphine as an opioid replacement therapy for people with heroin addiction or dependence confers a possible reduction of opioid use and with fewer depressive symptoms but overall more adverse effects when compared to other forms of long-acting opioids. The length of time in treatment was not found to be significantly different.
Sources: en.wikipedia.org
Legal status varies by country, but cardarine is not approved as a medicine in major jurisdictions. It is often sold as a research chemical, a category that may not be lawful for human use. Buyers should check local laws and product labels carefully.
Anti-doping laboratories use LC-MS/MS to detect GW501516 and its metabolites, usually in urine. The method can identify the parent compound at low concentrations. Detection windows vary with dose and individual factors.
No, cardarine has no approved medical uses in major jurisdictions. Early research explored metabolic conditions, but those programs were discontinued. It is not a registered treatment for any disease.
Yes, WADA prohibits cardarine as a PPARδ agonist. It appears on the prohibited list and can be detected in urine or blood. Athletes using it risk sanctions.