Anti-doping comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-05-18. Where a claim depends on a specific study, the study is described rather than over-claimed.
Cardarine is the common name for GW501516, a synthetic compound studied as a peroxisome proliferator-activated receptor delta agonist. Researchers developed it to explore treatments for lipid disorders and metabolic conditions. It is not an approved medicine in any country. Early clinical work examined changes in HDL cholesterol and triglycerides, but development was discontinued after animal studies raised concerns about cancer. The compound remains available as a research chemical and appears in discussions of performance enhancement.
At the molecular level, GW501516 binds and activates PPARδ, a nuclear receptor that regulates transcription. Activation shifts expression of genes involved in fatty acid oxidation, energy expenditure, and lipid transport in skeletal muscle and liver. Animal studies report increased endurance and altered lipid profiles after exposure. Human data are limited to small trials and do not establish long-term safety or efficacy. PPARδ also has roles in cell proliferation, so the relationship between activation and cancer risk remains an open question.
Published literature on cardarine includes in vitro assays, rodent experiments, and a small number of human studies. Reports describe effects on exercise capacity and lipid metabolism in animals, while human evidence is sparse. Many online descriptions present the compound as a proven endurance aid, a claim not supported by regulatory approval or large clinical trials. Analytical studies focus on identifying the parent compound and its metabolites in biological samples. Important uncertainties include species differences, dose-response relationships, and the relevance of rodent tumor findings to humans.
GW501516 acts on PPARδ, a nuclear receptor that helps regulate fatty acid oxidation and energy homeostasis. In animal studies, activation of this receptor was associated with increased endurance and changes in lipid metabolism. Human trials examined effects on blood lipids and other metabolic markers, but the compound did not advance to approval. Rodent studies later reported tumors in multiple tissues at doses used in those experiments. Whether those findings translate to human risk remains uncertain, and the clinical relevance of the animal data is still debated.
Regulatory bodies treat GW501516 as a prohibited substance in competitive sport. The World Anti-Doping Agency added it to the prohibited list, and it falls under classes covering metabolic modulators and hormone-related agents. It is not approved by drug regulators for human use, and it is not a lawful dietary supplement. Products sold under the cardarine name may contain unlisted ingredients or different compounds. Because no approved product exists, quality and identity are not guaranteed by pharmaceutical manufacturing standards.
Cardarine is a common name for the investigational chemical GW501516, also written GW-1516. It was developed as a peroxisome proliferator-activated receptor delta agonist for metabolic conditions such as dyslipidemia. Early research focused on lipid handling and energy use in skeletal muscle and other tissues. The compound was never approved as a medicine. In public discussion, it is often grouped with performance-enhancing substances, although its receptor target differs from that of anabolic steroids or selective androgen receptor modulators. Regulatory and health authorities have issued warnings about its use.
| Property | Value | Notes |
|---|---|---|
| Common name | Cardarine | Also called GW501516 and endurobol. |
| Chemical formula | C21H18F3NO3S2 | Molecular weight about 453.5 g/mol. |
| Appearance | White to off-white solid | Form depends on synthesis and purity. |
| Solubility | Soluble in DMSO and ethanol | Low solubility in water. |
| Typical storage | -20 °C, desiccated, protected from light | Common for research chemicals. |
Cardarine can be detected in biological samples and product materials using liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS). The method separates compounds by chromatography and identifies them by mass-to-charge transitions, allowing low-level detection in urine or blood. Sample preparation often involves enzymatic hydrolysis, solid-phase extraction, or protein precipitation. Certified reference materials and isotope-labeled internal standards improve quantification. Detection windows depend on metabolism, matrix, and assay sensitivity, so no single universal window applies.
Regulatory treatment of cardarine differs by context and jurisdiction. In competitive sport, the World Anti-Doping Agency lists PPARδ agonists, including GW501516, as prohibited at all times. Outside sport, it lacks approval as a prescription medicine in major drug markets, and products sold for human consumption may be treated as unapproved drugs. Some countries also restrict importation or sale through general consumer protection and medicines laws. These classifications affect availability, testing, and legal risk without establishing therapeutic value.
Because cardarine is not an approved medicine, no pharmacopeial monograph defines its identity, purity, or storage requirements. Laboratories typically rely on in-house methods and reference standards when testing materials labeled as GW501516. Certificates of analysis may report purity and identity for a specific batch, but their scope varies and they do not guarantee safety or legal status. Independent verification can include high-performance liquid chromatography, mass spectrometry, nuclear magnetic resonance, and elemental analysis. The distinction between research chemical labeling and human use is significant because quality standards and oversight differ.
GW501516 acts as a ligand for PPAR delta, a nuclear receptor that regulates transcription of genes involved in fatty acid oxidation and energy use. Activation of this receptor in skeletal muscle shifts metabolism toward fat burning in animal models. The compound does not burn fat directly; it changes gene expression over hours to days. Researchers study it to understand metabolic flexibility and exercise adaptation. Effects observed in rodents are not automatically expected in humans.
Preclinical research reported that GW501516 increased running endurance in mice and improved lipid profiles in some animal species. Early human trials explored effects on high-density lipoprotein cholesterol, triglycerides, and glucose handling, but the program was discontinued. Published human data are sparse and do not establish efficacy for any condition. Studies also examined PPAR delta in cancer biology, with conflicting findings across models. The relationship between receptor activation, tissue context, and disease risk remains an active area of investigation.
Anti-doping laboratories identify GW501516 and its metabolites using liquid chromatography-tandem mass spectrometry. Urine is the usual matrix, and detection can occur after the parent compound has cleared from blood. The exact detection window depends on dose, formulation, individual metabolism, and assay sensitivity. Because the compound is prohibited at all times, athletes are subject to testing in and out of competition. Analytical methods continue to improve as new metabolites and designer analogs are characterized.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
Addressing the United Nations General Assembly, Lula compared "using lethal force in situations that do not constitute armed conflict" to "executing people without trial." Mexican President Claudia Sheinbaum stated in October: "We do not agree with these attacks, with the way they are being carried out." Mexico and the US agreed in November 2025 on a protocol whereby "Mexico's Navy will be responsible for intercepting these vessels in international waters near the country's coasts in order to prevent further bombings", according to El País. Foreign Policy magazine described Latin America's reaction to the strikes as "disjointed" and fragmented in November 2025, "explained, in part, by ideological divisions across the region", with "left-wing leaders of Colombia, Mexico, and Brazil [as] the most vocal critics of the strikes", while "countries with right-wing leaders—such as Paraguay, Argentina, and Ecuador—have generally aligned themselves with the Trump administration's approach to drug trafficking and Maduro.
=== Alkanes === For linear alkanes, molecular ion peaks are often observed. However, for long chain compounds, the intensity of the molecular ion peaks are often weak. Linear fragments often differ by 14 Da (CH2 = 14). For example, hexane fragmentation patterns. The m/z=57 butyl cation is the base peak, and other most abundant peaks in the spectrum are alkyl carbocations at m/z=15, 29, 43 Da.
== Operations == MrMed's headquarters are in Chennai, with dispatch hubs located in Delhi and Bangalore. According to the Economic Times, the company reported an Annual Recurring Revenue (ARR) of ₹26 crore. In April 2024, the company entered the offline retail segment with the opening of its first store in Chennai.
Sources: en.wikipedia.org
Uhthoff's phenomenon, a reversible exacerbation of symptoms following a rise in body temperature, and Lhermitte's sign, an electrical sensation that runs down the back when flexing the neck, are particularly characteristic of MS, although may not always be present. 60–80% of MS patients find that symptoms, such as fatigue, are affected by changes in body temperature. MS may also present with eye movement impairments, such as internuclear ophthalmoplegia or sixth nerve palsy.
There are multiple levels of metabolic regulation. In intrinsic regulation, the metabolic pathway self-regulates to respond to changes in the levels of substrates or products; for example, a decrease in the amount of product can increase the flux through the pathway to compensate. This type of regulation often involves allosteric regulation of the activities of multiple enzymes in the pathway. Extrinsic control involves a cell in a multicellular organism changing its metabolism in response to signals from other cells. These signals are usually in the form of water-soluble messengers such as hormones and growth factors and are detected by specific receptors on the cell surface. These signals are then transmitted inside the cell by second messenger systems that often involved the phosphorylation of proteins. A very well understood example of extrinsic control is the regulation of glucose metabolism by the hormone insulin. Insulin is produced in response to rises in blood glucose levels. Binding of the hormone to insulin receptors on cells then activates a cascade of protein kinases that cause the cells to take up glucose and convert it into storage molecules such as fatty acids and glycogen. The metabolism of glycogen is controlled by activity of phosphorylase, the enzyme that breaks down glycogen, and glycogen synthase, the enzyme that makes it. These enzymes are regulated in a reciprocal fashion, with phosphorylation inhibiting glycogen synthase, but activating phosphorylase.
== Mechanical characteristics == While many uses of ivory are purely ornamental in nature, it often must be carved and manipulated into different shapes to achieve the desired form. Other applications, such as ivory piano keys, introduce repeated wear and surface handling of the material. It is therefore essential to consider the mechanical properties of ivory when designing alternatives. Elephant tusks are the animal's incisors, so the composition of ivory is unsurprisingly similar to that of teeth in several other mammals. It is composed of dentine, a biomineral composite constructed from collagen fibers mineralized with hydroxyapatite. This composite lends ivory the impressive mechanical properties—high stiffness, strength, hardness, and toughness—required for its use in the animal's day-to-day activities. Ivory has a measured hardness of 35 on the Vickers scale, exceeding that of bone. It also has a flexural modulus of 14 GPa, a flexural strength of 378 MPa a fracture toughness of 2.05 MPam1/2. These measured values indicate that ivory mechanically outperforms most of its most common alternatives, including celluloid plastic and polyethylene terephthalate. Ivory's mechanical properties result from the microstructure of the dentine tissue. It is thought that the structural arrangement of mineralized collagen fibers could contribute to the checkerboard-like Schreger pattern observed in polished ivory samples. This is often used as an attribute in ivory identification.
Sources: en.wikipedia.org
The same properties of the isotope make it useful for brachytherapy, and for certain nuclear medicine scanning procedures, in which it is attached to proteins (albumin or fibrinogen), and where a half-life longer than that provided by 123I is required for diagnostic or lab tests lasting several days. Iodine-125 can be used in scanning/imaging the thyroid, but iodine-123 is preferred for this purpose, due to better radiation penetration and shorter half-life (13 hours). 125I is useful for glomerular filtration rate (GFR) testing in the diagnosis or monitoring of patients with kidney disease. Iodine-125 is used therapeutically in brachytherapy treatments of tumors. For radiotherapy ablation of tissues that absorb iodine (such as the thyroid), or that absorb an iodine-containing radiopharmaceutical, the beta-emitter iodine-131 is the preferred isotope. When studying plant immunity, 125I is used as the radiolabel in tracking ligands to determine which plant pattern recognition receptors (PRRs) they bind to. 125I is produced by the electron capture decay of 125Xe, which is an artificial isotope of xenon, itself created by neutron capture on nearly-stable 124Xe (it undergoes double electron capture with a half-life orders of magnitude larger than the age of the universe), which makes up around 0.1% of naturally occurring xenon.
=== Hydration === Rattlesnakes are believed to require at least their own body weight in water annually to remain hydrated. The method by which they drink depends on the water source. In larger bodies of water (streams, ponds, etc.), they submerge their heads and ingest water by opening and closing their jaws, which sucks in water. If drinking dew or small puddles, they sip the liquid either by capillary action or by flattening and flooding their lower jaws. In desert environments, scientists observe that rattlesnakes have evolved to stay hydrated by coiling up and flattening so that their bodies can collect rain. In some instances, they aggregated in a carpet-like formation to make a larger rain-collecting platform.
It aids in sequencing and annotating genomes and their observed mutations. Bioinformatics includes text mining of biological literature and the development of biological and gene ontologies to organize and query biological data. It also plays a role in the analysis of gene and protein expression and regulation. Bioinformatic tools aid in comparing, analyzing, and interpreting genetic and genomic data and in the understanding of evolutionary aspects of molecular biology. At a more integrative level, it helps analyze and catalogue the biological pathways and networks that are an important part of systems biology. In structural biology, it aids in the simulation and modeling of DNA, RNA, proteins as well as biomolecular interactions.
Sources: en.wikipedia.org
Cardarine is a common name for the investigational compound GW501516. It acts as a PPARδ agonist and is not approved for human use. It is prohibited in sport.
It activates PPARδ, a nuclear receptor that influences gene expression related to lipid and energy metabolism. Animal studies show changes in endurance and lipid levels. Human effects and risks are not well established.
No, cardarine is not a steroid. It belongs to a different chemical class, the PPARδ agonists. It is also not a selective androgen receptor modulator.
No. Cardarine is a PPARδ agonist, while selective androgen receptor modulators act on androgen receptors. The two classes differ in receptor target and downstream effects.