If you have been reading about fatty acid oxidation and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-04-30. Where a claim depends on a specific study, the study is described rather than over-claimed.
Activation of PPARδ changes transcription of genes involved in fatty acid transport, mitochondrial function, and skeletal muscle fuel preference. In rodent studies, pharmacological PPARδ activation was associated with increased endurance and altered body composition. These findings generated interest in performance enhancement, but species differences and study designs limit direct extrapolation to humans. Small human trials were conducted in the 2000s and later discontinued. The extent to which cardarine produces similar metabolic or performance effects in people remains an open question.
The compound is typically described as a laboratory compound rather than a therapeutic product. Published reports have explored its role in lipid disorders, insulin sensitivity, and exercise metabolism, yet no major drug regulator has approved it for medical use. Commercial samples sold under the cardarine name may vary in purity and identity. Analytical confirmation is therefore necessary when the material is discussed in scientific or regulatory contexts. Its classification as a prohibited substance in sport further shapes how it is studied and reported.
Cardarine is a common name for GW501516, a synthetic compound studied for its effects on lipid and glucose metabolism. It functions as an agonist at peroxisome proliferator-activated receptor delta, or PPARδ, a nuclear receptor that influences gene expression. The molecule is not a steroid, nor is it a selective androgen receptor modulator. It is also known in research and sports literature as GW-501516 and endurobol. Early laboratory work examined its metabolic activity in cell cultures and animal models.
GW501516 acts as an agonist at peroxisome proliferator-activated receptor delta, a nuclear receptor involved in transcription of genes related to lipid handling and energy use. Activation of PPARδ can shift skeletal muscle toward greater fatty acid oxidation in animal models, which is one reason it drew interest for metabolic disease and exercise research. The exact downstream effects depend on tissue, species, dose, and duration. Human data are sparse, so many proposed benefits remain hypotheses rather than established clinical outcomes.
Laboratory studies have examined GW501516 in cell cultures and rodents for conditions such as dyslipidemia, insulin resistance, and obesity. Some trials in humans were initiated, but development was discontinued after preclinical findings raised concerns about cancer in certain models. Those findings do not prove that the compound causes cancer in people, but they contributed to regulatory caution. Later reviews often describe the evidence as preliminary and insufficient for assessing long-term safety.
In the fitness and bodybuilding literature, cardarine is frequently discussed as an endurance agent or fat-loss compound, although such claims are not supported by robust clinical evidence. Online descriptions often mix animal data, user anecdotes, and marketing language. Researchers who study PPARδ agonists distinguish between receptor activation in controlled experiments and unsupervised use of unverified products. The latter introduces unknown purity, dose, and interactions, making reported experiences difficult to interpret scientifically.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic PPARδ agonist | Not a steroid or a selective androgen receptor modulator. |
| Common synonyms | Cardarine, GW501516, GW-501516, endurobol | Names vary by supplier and literature source. |
| Appearance | White to off-white powder | Consistent with many small-molecule research chemicals. |
| Solubility | Low in water; soluble in DMSO and ethanol | Often prepared in organic solvent for laboratory work. |
| Primary target | PPARδ (NR1C2) | Nuclear receptor involved in lipid and energy metabolism. |
At the molecular level, GW501516 binds and activates PPARδ, a nuclear receptor that regulates transcription. Activation shifts expression of genes involved in fatty acid oxidation, energy expenditure, and lipid transport in skeletal muscle and liver. Animal studies report increased endurance and altered lipid profiles after exposure. Human data are limited to small trials and do not establish long-term safety or efficacy. PPARδ also has roles in cell proliferation, so the relationship between activation and cancer risk remains an open question.
Published literature on cardarine includes in vitro assays, rodent experiments, and a small number of human studies. Reports describe effects on exercise capacity and lipid metabolism in animals, while human evidence is sparse. Many online descriptions present the compound as a proven endurance aid, a claim not supported by regulatory approval or large clinical trials. Analytical studies focus on identifying the parent compound and its metabolites in biological samples. Important uncertainties include species differences, dose-response relationships, and the relevance of rodent tumor findings to humans.
Cardarine is the common name for GW501516, a synthetic compound studied as a peroxisome proliferator-activated receptor delta agonist. Researchers developed it to explore treatments for lipid disorders and metabolic conditions. It is not an approved medicine in any country. Early clinical work examined changes in HDL cholesterol and triglycerides, but development was discontinued after animal studies raised concerns about cancer. The compound remains available as a research chemical and appears in discussions of performance enhancement.
A common misconception is that cardarine has been proven safe for human use. In reality, human clinical data are limited, and long-term animal studies have raised concerns about cancer. Another misconception is that it is a supplement or vitamin-like compound. It is a synthetic research chemical with no approved medical indication. Scientific discussion often focuses on its mechanism and detection rather than therapeutic use. Regulatory and anti-doping literature treats it primarily as a prohibited substance.
Cardarine is explicitly prohibited by the World Anti-Doping Agency under the class of PPARδ agonists. Its presence in urine or blood samples can be detected using mass spectrometry-based methods, often liquid chromatography-tandem mass spectrometry. Athletes who test positive may face sanctions, including bans from competition. The compound is also regulated as a prescription-only or unapproved drug in many countries. Enforcement varies by jurisdiction, and some regions treat it as a controlled substance. Online sales may occur despite these restrictions, creating quality and legal risks.
Laboratory detection of cardarine typically involves sample preparation followed by chromatographic separation and mass spectrometric identification. Urine is the most common matrix for anti-doping tests, though blood and hair have also been explored. Methods can target the parent compound or its metabolites, depending on the expected window of detection. Reference standards are required for accurate quantification. Matrix effects and dilution can influence results, so laboratories use internal standards and validation protocols. The exact detection window varies with dose, route, and individual metabolism.
Literature on cardarine often separates receptor pharmacology from toxicology. Mechanistic papers describe PPARδ activation and gene expression changes, while safety assessments focus on carcinogenicity and species differences. Questions remain about whether rodent tumors arise through PPARδ-dependent or off-target mechanisms. Another open area is how human metabolism and exposure compare with those in animal studies. Analytical methods such as liquid chromatography–mass spectrometry are used to confirm identity in biological and product samples.
GW501516 acts as an agonist at the peroxisome proliferator-activated receptor delta, a nuclear receptor that regulates gene expression. Activation shifts transcription toward genes involved in fatty acid uptake, oxidation, and energy expenditure. The compound does not bind the androgen receptor and therefore differs from anabolic steroids and SARMs. In rodent models, this metabolic shift has been linked to increased running endurance and reduced fat accumulation. The exact downstream pathways in humans remain incompletely characterized.
Inhibition of p38 MAPK selectively blocks stress-induced immobility and conditioned place aversion while preserving analgesia and non-selective learning processes, isolating p38 signaling as specifically responsible for dysphoric-like behavioral responses. Evidence suggests that G protein signaling mediates the therapeutic analgesic and antipruritic effects of KOR agonists, whilst β-arrestin2-dependent signaling through p38 MAPK activation mediates adverse dysphoric, sedative, and aversive effects. Experiments in β-arrestin2 knockout mice demonstrated that the antipruritic effects of KOR agonists are preserved in the absence of β-arrestin2, whilst conditioned place aversion requires both GRK3 and β-arrestin2.
Jenner sent a paper reporting his observations to the Royal Society in April 1797. It was not submitted formally and there is no mention of it in the Society's records. Jenner had sent the paper informally to Sir Joseph Banks, the Society's president, who asked Everard Home for his views. Reviews of his rejected report, published for the first time in 1999, were skeptical and called for further vaccinations. Additional vaccinations were performed and in 1798 Jenner published his work entitled An Inquiry into the Causes and Effects of the Variolae Vaccinae, a disease discovered in some of the western counties of England, particularly Gloucestershire and Known by the Name of Cow Pox. It was an analysis of 23 cases including several individuals who had resisted natural exposure after previous cowpox. It is not known how many Jenner vaccinated or challenged by inoculation with smallpox virus; e.g. Case 21 included 'several children and adults'. Crucially all of at least four whom Jenner deliberately inoculated with smallpox virus resisted it. These included the first and last patients in a series of arm-to-arm transfers. He concluded that cowpox inoculation was a safe alternative to smallpox inoculation, but rashly claimed that the protective effect was lifelong. This last proved to be incorrect. Jenner also tried to distinguish between 'True' cowpox which produced the desired result and 'Spurious' cowpox which was ineffective and/or produced severe reaction.
Sulfur dioxygenase (EC 1.13.11.18, sulfur oxygenase, sulfur:oxygen oxidoreductase) is an enzyme with systematic name S-sulfanylglutathione:oxygen oxidoreductase. This enzyme catalyses the following chemical reaction
Sources: en.wikipedia.org
Tolkien's Middle-earth fantasy writings have been said to embody outmoded attitudes to race. However, scholars have noted that he was influenced by Victorian attitudes to race and to a literary tradition of monsters, and that he was anti-racist both in peacetime and during the two World Wars. With the late-19th-century background of eugenics and a fear of moral decline, some critics believe that the mention of race mixing in The Lord of the Rings embodies scientific racism. Critics have noted, too, that the work embodies a moral geography, with good in the West, evil in the East. Against this, Tolkien strongly opposed Nazi racial theories, as seen in a 1938 letter he wrote to his publisher, while during the Second World War he vigorously opposed anti-German propaganda. His Middle-earth has been described as definitely polycultural and polylingual, while scholars have noted that attacks on Tolkien based on The Lord of the Rings often omit relevant evidence from the text. A spokesman for HarperCollins, publisher of the trilogy, said: "A number of academics have commented on Tolkien's work and this is the first time anybody has ever seen these issues in it. Of course, if you look hard enough at many great epics, you can extrapolate what you like, particularly if you have academic kudos behind you."
== Background == Even before the April 1775 Battles of Lexington and Concord in Massachusetts, both the Americans and British knew that passage on the Hudson River was strategically important to each sides’ war effort. The Americans were desperate to control the river, lest New England be divided from the rest of the colonies. The immediate American plan was to slow or block ship traffic on the river by attacking British vessels with cannon and mortars from both shores. This anticipated batteries at both existing and planned defensive fortifications. In late 1776 Henry Wisner, a resident of Goshen, New York, and one of New York's representatives to the Continental Congress, along with Gilbert Livingston, sounded the Hudson River and, as part of a Secret Committee of the "Committee of Safety," recommended the placement of chains in strategic locations along the Hudson. Colonial forces eventually constructed three obstacles across the river: a chevaux-de-frise at northern Manhattan between Forts Washington and Lee in 1776; at the lower entrance to the Hudson Highlands, from newly constructed Fort Montgomery on the west bank at Popolopen Creek just north of the modern-day Bear Mountain Bridge to Anthony's Nose on the east bank in 1776–1777; and between West Point and Constitution Island in 1778, known as the Great Chain. A fourth, a cheval-de-frise started in 1776 between Plum Point on the east bank and Pollepel Island north of West Point, was begun but abandoned.
Guided bone regeneration (GBR) and guided tissue regeneration (GTR) are dental surgical procedures that use barrier membranes to direct the growth of new bone and gingival tissue at sites with insufficient volumes or dimensions of bone or gingiva for proper function, esthetics or prosthetic restoration. Guided bone regeneration typically refers to ridge augmentation or bone regenerative procedures; guided tissue regeneration typically refers to regeneration of periodontal attachment.
This is a methylation reaction in which glycocyamine is converted to creatine. The methyl group comes from the cofactor, S-adenosyl methionine (SAM), which loses its methyl group and becomes S-adenosyl-L-homocysteine (SAH). This enzyme belongs to the family of transferases, specifically those transferring one-carbon group methyltransferases. The systematic name of this enzyme class is S-adenosyl-L-methionine:N-guanidinoacetate methyltransferase. Other names in common use include GA methylpherase, guanidinoacetate methyltransferase, guanidinoacetate transmethylase, methionine-guanidinoacetic transmethylase, and guanidoacetate methyltransferase. It participates in the metabolism of amino acids. Defects in the gene which encodes this protein have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals. Two transcript variants encoding different isoforms have been described for this gene.
Sources: en.wikipedia.org
=== Deep learning reconstruction === Deep learning approaches extend traditional acceleration methods by training neural networks on large datasets of paired undersampled and fully-sampled MRI scans, enabling image reconstruction at higher acceleration factors than classical parallel imaging alone. Rather than relying on hand-crafted sparsity priors as in compressed sensing, these models learn reconstruction directly from data. One prominent approach, the end-to-end variational network (E2E-VarNet), combines sensitivity map estimation and iterative refinement in a fully learned pipeline, achieving state-of-the-art reconstruction quality on the fastMRI benchmark for both knee and brain MRI.. The fastMRI initiative, a collaboration between Meta AI Research (FAIR) and NYU Langone Health, established the field's primary open benchmark by releasing over 1.5 million raw MRI measurements from knee, brain, and prostate scans in 2018. Annual fastMRI challenges have benchmarked reconstruction quality across international research teams. A clinical interchangeability study confirmed that deep learning reconstruction at 4× acceleration produces images diagnostically equivalent to fully-sampled acquisitions for knee imaging at 3T, and these methods have since been adopted clinically at major medical centers.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
After six weeks of indecision, Mahathir was appointed deputy prime minister on 5 March 1976. Several political figures praised his appointment, recognizing his proven ability and experience. The appointment meant that Mahathir was the anointed successor to the prime ministership. In October, Mahathir was appointed to lead a cabinet committee to review the Petroleum Development Act. To address the growing drug problem, Mahathir launched a nationwide anti-drug campaign in 1978 and announced plans to build a large rehabilitation centre on Pisang Island, Johor. He later warned that if the issue was not addressed, drug abuse could lead to the destruction of the nation. Mahathir is regarded as having been a successful Minister of Education and then Minister of Trade and Industry (1978–81). In the latter post, he implemented a "heavy industries policy", establishing a HICOM, a government-controlled corporation, to invest in the long-term development of manufacturing sectors such as an indigenous car industry. He spent much of his time in the ministry promoting Malaysia through overseas visits. Besides this, as UMNO deputy president, he played a key role in coordinating among the ten component parties of the ruling Barisan Nasional coalition. In the 1978 general election, Mahathir served as BN's election director for the state of Perak. In September 1978, Mahathir launched the Central Unit of the Federal Industrial Development Authority, a streamlined "one-stop agency" aimed at simplifying the application process for licences, permits, and facilities.
Now perhaps it's a pretty well kept secret that one of the most uninspiring acts of the University of Cambridge over this past century was to turn down Francis Crick when he applied to be the Professor of Genetics, in 1958. Now there may have been a series of arguments, which led them to reject Francis. It was really saying, don't push us to the frontier. The apparently "pretty well kept secret" had already been recorded in Soraya De Chadarevian's Designs For Life: Molecular Biology After World War II, published by Cambridge University Press in 2002. His major contribution to molecular biology in Cambridge is well documented in The History of the University of Cambridge: Volume 4 (1870 to 1990), which was published by CUP in 1992. According to the University of Cambridge's genetics department official website, the electors of the professorship could not reach consensus, prompting the intervention of then University Vice-Chancellor Lord Adrian. Lord Adrian first offered the professorship to a compromise candidate, Guido Pontecorvo, who refused, and is said to have offered it then to Crick, who also refused. In 1976, Crick took a sabbatical year at the Salk Institute for Biological Studies in La Jolla, California. Crick had been a nonresident fellow of the Institute since 1960. Crick wrote, "I felt at home in Southern California." After the sabbatical, Crick left Cambridge to continue working at the Salk Institute. He was also an adjunct professor at the University of California, San Diego. He taught himself neuroanatomy and studied many other areas of neuroscience research.
For example, Nature published a total of 1,782 articles in the 2015/2016 biennium (902 articles in 2015 and 880 in 2016); and 74,090 references listed by articles published (by any journal) in 2017 were sourced from within the group of 1,782 articles that Nature had published during the previous two years. These figures yielded an impact factor of
Sources: en.wikipedia.org
Cardarine is a common name for GW501516, a synthetic PPARδ agonist. It is not a steroid or a selective androgen receptor modulator. It was developed and studied as a research compound for metabolic pathways.
It binds to and activates PPARδ, a nuclear receptor that regulates genes related to fatty acid oxidation and energy use. This activation alters transcription in tissues such as skeletal muscle and liver. The full range of downstream effects in humans is not fully established.
No, cardarine is not known to occur naturally in plants, animals, or humans. It is a synthetic molecule produced for laboratory research. Products labeled as cardarine should therefore be treated as manufactured chemicals with variable purity.
It binds and activates PPARδ, a nuclear receptor that influences gene expression related to fatty acid metabolism and energy balance. This mechanism has been studied mainly in animals and cell models, not established as a safe human therapy.